• Wholesale Muscle Enhance Growth Hormone Peptides CJC 1295 Without Dac 2mg / Vial from china suppliers
    Growth Hormone Peptides Steroid Cjc - 1295 Without Dac 2mg / vial for Muscle Enhance Quick Details: CJC-1295 without DAC CAS 863288-34-0 Molecular Formula: C152H252N44O42 Molecular weight: 3367.2 Molar Mass: 3368.7 Peptide purity: > 98.0% Appearance: White lyophilized powder Related substance: Total Impurities (%) ≤ 2.0% Acetate content: ≤ 15.0% Bacterial Endotoxins: ≤5 IU/mg Sequence: Tyr-d-ALA-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Le more
    Brand Name:Shuangbojie
    Model Number:863288-34-0
    Place of Origin:China

    Muscle Enhance Growth Hormone Peptides CJC 1295 Without Dac 2mg / Vial

  • Wholesale Cjc 1295 With Dac 2mg Usage Polypeptide Hormones for Bodybuilding from china suppliers
    Cjc 1295 With Dac 2mg Usage Polypeptide Hormones for Bodybuilding CJC-1295 DAC Chemical Profile CAS: 863288-34-0 Formula: C165H269N47O46 Molecular weight: 3647.28 Peptide purity: > 99.0% Chain: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Description CJC-1295 DAC contains 30 amino acids. CJC-1295 DAC, also known as growth hormone releasing factor (GRF MOD (1-29) or GHRF), is an analogue of GHR more
    Brand Name:Shanghai Stero
    Model Number:Cjc 1295 With Dac
    Place of Origin:China

    Cjc 1295 With Dac 2mg Usage Polypeptide Hormones for Bodybuilding

  • Wholesale CJC - 1295 With DAC , 2mg / Vial Peptide Hormones Bodybuilding Fat Burning 	Peptide 863288-34-0 from china suppliers
    ...CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 CJC-1295: CJC-1295, also known as DAC:GRF (short for drug affinity complex:growth hormon-releasing factor), is a synthetic analogue of growth... more
    Brand Name:Pharm
    Model Number:hannah@chembj.com
    Place of Origin:whatsapp: +86 138 7101 4054

    CJC - 1295 With DAC , 2mg / Vial Peptide Hormones Bodybuilding Fat Burning Peptide 863288-34-0

  • Wholesale CJC-1295 Without DAC 2mg Lyophilized Peptide High Purity CJC-1295 No DAC from china suppliers
    ...CJC-1295 Without DAC 2mg Lyophilized Peptide High Purity CJC-1295 No DAC Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price served; ... more
    Brand Name:steriodshow
    Model Number:CJC-1295 Without DAC (2mg/vial)
    Place of Origin:china manufactuer

    CJC-1295 Without DAC 2mg Lyophilized Peptide High Purity CJC-1295 No DAC

  • Wholesale Powerful Growth Hormone Peptides CJC-1295 with DAC 2mg /Vial for Bodybuilding from china suppliers
    ... Product Name CJC-1295 With DAC Chemical Name CJC-1295 DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873.01 Specification 2mg/10vials/kit Assay 99.5% Appearance White powder CJC-1295 With DAC Description CJC-1295 is basically... more
    Brand Name:Sendi
    Model Number:Pharmaceutical Grade
    Place of Origin:China

    Powerful Growth Hormone Peptides CJC-1295 with DAC 2mg /Vial for Bodybuilding

  • Wholesale 99% Purity White Powder Protein Peptide Hormones Cjc-1295 With Dac (2mg/vial) Fat Loss Human Growth from china suppliers
    ...Quick Detail: Product Name CJC-1295 With DAC / CJC-1295 DAC Synonyms CJC1295(GHRH/DAC), CJC1295 DAC(Drug Affinity Complex), CJC-1295 with dac, CJC 1295 CAS 863288-34-0 MF C165H269N47O46 MW 3647.19 Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-... more
    Brand Name:Muscle Man
    Model Number:CAS 863288-34-0
    Place of Origin:Hunan,China

    99% Purity White Powder Protein Peptide Hormones Cjc-1295 With Dac (2mg/vial) Fat Loss Human Growth

  • Wholesale CJC1295 Without DAC High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial 863288-34-0 from china suppliers
    ...High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial , CAS 863288-34-0 Not only has Cjc1295 shown the ability to increase hormone and ... more
    Brand Name:CJC-1295 Without DAC
    Model Number:863288-34-0
    Place of Origin:China

    CJC1295 Without DAC High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial 863288-34-0

    JCJ Logis Co.,ltd
  • Wholesale Muscle Mass Growth Hormone Releasing Peptide GHRH CJC-1295 With DAC 2mg from china suppliers
    ...DAC 2mg Growth Releasing Hormone Peptides GHRH Muscle Mass 1, CJC-1295 With DAC Profile: Product Name: CJC-1295 With DAC / CJC-1295 DAC Specification: 2mg per vial Synonyms: CJC1295(GHRH/DAC), CJC1295 DAC(Drug Affinity Complex), CJC-1295 with dac, CJC 1295... more
    Brand Name:Blue Dragon
    Model Number:CJC-1295 With DAC 2mg
    Place of Origin:China Manufacturer

    Muscle Mass Growth Hormone Releasing Peptide GHRH CJC-1295 With DAC 2mg

  • Wholesale Human Growth Peptides CJC 1295 Without DAC 2mg / vial For Bodybuilder from china suppliers
    ... DAC 2mg / vial For Bodybuilder Quick detail : CJC-1295 without DAC Welcome to your inquiry ! Contact Abby by trustful@ycgmp.com Skype:mia9403 Whatsapp:+8618826123740 Product name : CJC-1295 without dac Synonyms : CJC-1295 without DAC, CJC 1295 w/o DAC... more
    Brand Name:Huao(skype:mia9403)
    Model Number:CAS : 863288-34-0
    Place of Origin:China

    Human Growth Peptides CJC 1295 Without DAC 2mg / vial For Bodybuilder

  • Wholesale CAS 51753-57-2 Human Growth Peptides Cjc-1295 with Dac 2mg / Vial for Weight Loss from china suppliers
    ...High Quality Peptide 51753-57-2 Cjc-1295 with Dac 2mg/Vial for Weight Loss 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% MOQ: 1 kit Material: Pharmaceutical Raw Material Reship: ... more
    Brand Name:Gear Steroids
    Model Number:51753-57-2
    Place of Origin:China

    CAS 51753-57-2 Human Growth Peptides Cjc-1295 with Dac 2mg / Vial for Weight Loss

  • Wholesale Bodybuilding Injectable Growth Hormone Peptides Cjc 1295 With Dac 2mg / Vial from china suppliers
    ...99% Purity Injectable Peptides Cjc - 1295 With Dac 2mg / Vial for Bodybuilding Basic Details: CJC-1295 DAC Alias: CJC1295 with DAC Density: 1.45 Purity (HPLC): 98.0% Appearance: White powder Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% ... more
    Brand Name:Shuangbojie
    Model Number:Cjc-1295 With Dac
    Place of Origin:China

    Bodybuilding Injectable Growth Hormone Peptides Cjc 1295 With Dac 2mg / Vial

  • Wholesale HPLC 99% Purity Lab Peptides Cjc-1295 Without Dac , 2mg / vial 10 vials / kit from china suppliers
    ... Lab Peptides Cjc-1295 (2mg/vial, 10vials/kit) Peptides Cjc-1295 Without Dac CJC-1295 Without Dac CAS:87616-84-0 MF:C152H252N44O42 MW:3367.2 Purity (HPLC):98% Appearance: White powder The biggest proven advantage of Cjc-1295 Without Dac is that it... more
    Brand Name:HBU
    Model Number:87616-84-0
    Place of Origin:CHINA

    HPLC 99% Purity Lab Peptides Cjc-1295 Without Dac , 2mg / vial 10 vials / kit

  • Wholesale 863288-34-0 Growth Hormone Peptides CJC 1295 Without DAC 2mg / vial from china suppliers
    ...Growth Hormone Peptides CJC 1295 Without DAC 2mg/vial CAS 2mg/vial Alias CJC-1295 Acetate; CJC1295(Without DAC); CAS No 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.3 Purity (HPLC) 98.00% Appearance ... more
    Brand Name:Fulu
    Model Number:863288-34-0
    Place of Origin:China

    863288-34-0 Growth Hormone Peptides CJC 1295 Without DAC 2mg / vial

    SuZhou FuLu Biotech Co.,Ltd
  • Wholesale Medicine Grade Polypeptide CJC-1295 with DAC 2mg/vial For Fat Burning from china suppliers
    ...Medicine Grade Polypeptide CJC-1295 with DAC 2mg/vial For Fat Burning Buy CJC-1295 with DAC Online from rina at pharmade dot com Density:1.45 CJC-1295 with DAC Product Description: CJC-1295 2mg/Vial Type: Immune Function AgentsGrade Standard: Medicine ... more
    Brand Name:rina@pharmade.com
    Model Number:skype: zarazhou3
    Place of Origin:China

    Medicine Grade Polypeptide CJC-1295 with DAC 2mg/vial For Fat Burning

  • Wholesale Cjc 1295 Without Dac 2mg/Vial Legal Lyophilized Polypeptide 863288-34-0 from china suppliers
    ...Cjc 1295 Without Dac 2mg/Vial Legal Lyophilized Polypeptide 863288-34-0 Quick Detail: CJC 1295(Without DAC) Alias: CJC-1295 Acetate; CJC-1295(Without DAC) ; Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-... more
    Brand Name:JNJG
    Place of Origin:CHINA
    Certification:USP BP SGS KOSHER

    Cjc 1295 Without Dac 2mg/Vial Legal Lyophilized Polypeptide 863288-34-0

  • Wholesale Lyophilized Powder Peptide Human Hormone CJC-1295 without DAC  2mg For Muscle Building from china suppliers
    ...Quick detail: CAS No.:863288-34-0 Chemical Name: CJC-1295 without DAC Formula:C152H252N44O42 One Letter Sequence:Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 Three Letter Sequence:H-Tyr-D-Ala-Asp-Ala-Ile-... more
    Brand Name:ChineseHormone
    Model Number:863288-34-0
    Place of Origin:China

    Lyophilized Powder Peptide Human Hormone CJC-1295 without DAC 2mg For Muscle Building

  • Wholesale Human Growth Peptides Cjc-1295 with Dac 2mg / Vial for Increasing Muscle CAS 63288-34-0 from china suppliers
    ...Human Growth Peptides Cjc-1295 with Dac 2mg / Vial for Increasing Muscle CAS: 63288-34-0 Basic Info. Product Description: CJC-1295 2mg/Vial Type: Immune Function AgentsGrade Standard: Medicine Grade Classification: Brassinosteroid CAS: 63288-34-0 MF: ... more
    Brand Name:Pharmlab
    Model Number:863288-34-0
    Place of Origin:China

    Human Growth Peptides Cjc-1295 with Dac 2mg / Vial for Increasing Muscle CAS 63288-34-0

    Pharmlab Co.,Ltd
  • Wholesale CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding from china suppliers
    ...Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding CJC-1295 Basic Info Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-... more
    Brand Name:BestSteroid
    Model Number:863288-34-0
    Place of Origin:Hubei,China

    CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding

  • Wholesale Legal Safe Peptide Hormones Bodybuilding CJC-1295 without DAC 2mg / vial for Muscle Mass from china suppliers
    ...Legal Safe Peptide Hormones Bodybuilding CJC-1295 without DAC 2mg / vial for Muscle Mass 1. CJC-1295 without DAC basic: Name: CJC-1295 without DAC Synonyms: FST, FS, Activin-binding protein. Appearance: Sterile Filtered White Lyophilized (Freeze-Dried) ... more
    Brand Name:wumeitech
    Model Number:10vials
    Place of Origin:China

    Legal Safe Peptide Hormones Bodybuilding CJC-1295 without DAC 2mg / vial for Muscle Mass

  • Wholesale Cjc 1295 With Dac 2mg Usage Polypeptide Hormones for Bodybuilding from china suppliers
    ...Cjc 1295 With Dac 2mg Usage Polypeptide Hormones for Bodybuilding CJC-1295 DAC Chemical Profile CAS: 863288-34-0 Formula: C165H269N47O46 Molecular weight: 3647.28 Peptide purity: > 99.0% Chain: ... more
    Brand Name:Shanghai Stero
    Model Number:Cjc 1295 With Dac
    Place of Origin:China

    Cjc 1295 With Dac 2mg Usage Polypeptide Hormones for Bodybuilding

    Shanghai Stero R&D Co,. Ltd
  • Wholesale Lab API Peptide Bodybuilding Prohormones CJC-1295 without DAC 2mg/Vial from china suppliers
    ...Lab API Peptide CJC-1295 without DAC 2mg/Vial for Weight Loss Basic Information for CJC-1295 without DAC Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ... more
    Brand Name:Bodybuilding
    Model Number:863288-34-0
    Place of Origin:China

    Lab API Peptide Bodybuilding Prohormones CJC-1295 without DAC 2mg/Vial

  • Wholesale GHRH CJC 1295 with DAC 2mg / Vial , Peptides CJC 1295 DAC for Injection from china suppliers
    ...GHRH CJC 1295 with DAC 2mg/Vial, Peptides CJC 1295 DAC for Injection with Safe Shipment Detailed Product Description Brand Name CJC 1295 DAC Molecular Formula C165H269N47O46 Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-... more
    Brand Name:CJC-1295 DAC
    Model Number:CAS Number 863288-34-0
    Place of Origin:China

    GHRH CJC 1295 with DAC 2mg / Vial , Peptides CJC 1295 DAC for Injection

Tell “cjc 1295 with dac 2mg” Suppliers Your Requirement
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0