• Wholesale White Powder Long Acting Steroids For Bodybuilding Testosterone Decanote from china suppliers
    ...White Powder Long Acting Steroids Testosterone Decanote Bodybulider Best Choose Testosterone Decanoate Detail: Product name: Testosterone Decanoate Chemical name: 4-... more
    Brand Name:Shanghai Stero
    Model Number:5721-91-5 Testosterone Decanote
    Place of Origin:China

    White Powder Long Acting Steroids For Bodybuilding Testosterone Decanote

    Shanghai Stero R&D Co,. Ltd
    [Shanghai,China]
  • Wholesale Traveling Diabetes Insulin Pen Long Acting For Patients Attractive Design from china suppliers
    ...Long Acting Traveling With Insulin Pens / Diabetes Injection Pen Reusable Insulin Pen Compatible with standard 3ml cartridge Quick Detail: High quality plastic reusable pen at economic ... more
    Brand Name:Umitai
    Model Number:YST-IIG Fashion version
    Place of Origin:Shanghai, China

    Traveling Diabetes Insulin Pen Long Acting For Patients Attractive Design

  • Wholesale Long Acting Reusable FDA Insulin Injection Pen / Insulin Glargine Pen from china suppliers
    ... easy touch button, requires a light touch to deliver the insulin at all insulin dose. Dose setting mechanism permits dose corrections without loss of insulin, provides doses in 1 unit increments up to 72 units... more
    Brand Name:delfu
    Model Number:BZ-II
    Place of Origin:Jiangsu, China (Mainland)

    Long Acting Reusable FDA Insulin Injection Pen / Insulin Glargine Pen

  • Wholesale Anabolic Hormone Peptide Insulin Like Growth Factor-1 / IGF-1 LR3 White Solid 0.1mg/vial For Muscle Growth from china suppliers
    ... Growth Factor-1 / IGF-1 LR3 White Solid 0.1mg/vial For Muscle Growth Abstract Insulin like growth factor-1 (IGF-1) is a substance which in manufactured by recombinant DNA technology. IGF-1 is ... more
    Brand Name:YUANHANG
    Model Number:946870-92-4
    Place of Origin:CHINA

    Anabolic Hormone Peptide Insulin Like Growth Factor-1 / IGF-1 LR3 White Solid 0.1mg/vial For Muscle Growth

  • Wholesale 98% Legal Peptides Muscle Building IGF-1 LR3 Insulin - Like Growth Factor from china suppliers
    ...-1 is basically a polypeptide hormone that has the same some of the same molecular properties as insulin. IGF dose actually stand for insulin-like growth factor. IGF-1 is mainly responsible for long bone more
    Brand Name:kafen
    Model Number:946870-92-4
    Place of Origin:China

    98% Legal Peptides Muscle Building IGF-1 LR3 Insulin - Like Growth Factor

  • Wholesale IGF-1 LR3 / LONG IGF-1 CAS 946870-92-4 Peptide Steroid Hormones for Weight Loss from china suppliers
    ...-1, LONG R3IGF-1. Description: The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. Recombinant Human LR3 Insulin Like... more
    Brand Name:Nanjian
    Model Number:WuHan20170201
    Place of Origin:China

    IGF-1 LR3 / LONG IGF-1 CAS 946870-92-4 Peptide Steroid Hormones for Weight Loss

  • Wholesale 95% IGF-1 LR3 0.1mg Injectable Peptide Long R3IGF1 1mg Male Enhancement Steroids from china suppliers
    ...: Product name: IGF-1 LR3 Synonyms: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1, LR3 IGF1 Human Specification: 0.1mg & 1mg per vial CAS#: 946870-92... more
    Brand Name:Blue Dragon
    Model Number:IGF-1 LR3 (1mg & 0.1mg)
    Place of Origin:China Manufacturer

    95% IGF-1 LR3 0.1mg Injectable Peptide Long R3IGF1 1mg Male Enhancement Steroids

  • Wholesale Insulin Glargine Rdna Origin Injectio 300 Units/3 mL , 1000 Units/10 mL from china suppliers
    ... : one vial/box Description: Insulin glargine [rDNA origin] injection is a sterile solution of insulin glargine for use as a subcutaneous injection. Insulin glargine is a recombinant human insulin analog that is a long-acting (up to 24-hour duration... more
    Brand Name:Newlystar
    Model Number:300 Units/3 mL, 1000 Units/10 mL
    Place of Origin:China

    Insulin Glargine Rdna Origin Injectio 300 Units/3 mL , 1000 Units/10 mL

  • Wholesale Pramlintide Acetate Polypeptide Hormones Treating Insulin Dependent Diabetes Polypeptide Amylin from china suppliers
    ...Pramlintide Acetate Polypeptide Hormones Treating Insulin Dependent Diabetes Polypeptide Amylin Basic Info. Name: Pramlintide Acetate Cas No.: 196078-30-5 Molecular Formula: ... more
    Brand Name:HKYC
    Model Number:196078-30-5
    Place of Origin:China

    Pramlintide Acetate Polypeptide Hormones Treating Insulin Dependent Diabetes Polypeptide Amylin

  • Wholesale Wrinkle Remover HGH Human Growth Hormone Supplements IGF-LR3 Insulin-like Growth Factors to boost muscle mass from china suppliers
    ...Wrinkle Remover HGH Human Growth Hormone Supplements IGF-LR3 Insulin-like Growth Factors to boost muscle mass >>>>>>>>>>>>>IGF-LR3 Quick Details Class HGH Human Growth ... more
    Brand Name:human growth hormones
    Model Number:IGF-LR3
    Place of Origin:China

    Wrinkle Remover HGH Human Growth Hormone Supplements IGF-LR3 Insulin-like Growth Factors to boost muscle mass

  • Wholesale Prescription Human Growth Hormone Anabolic Steroid Igtropin Long R3 IGF 1 from china suppliers
    ... 301.30 Package 100mcg(0.1mg)*10vials/kit Storage Closed, below 2 ~ 8℃ preservation Origin China Igtropin (Long-R3 IGF-1) Function : 1. improved amino acid transport cells 2. increased glucose transport 3. enlarged protein synthesis 4. reduced more
    Brand Name:GB
    Place of Origin:China
    Certification:ISO9001

    Prescription Human Growth Hormone Anabolic Steroid Igtropin Long R3 IGF 1

  • Wholesale CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 from china suppliers
    ...-1 Des1-3 is purified by proprietary chromatographic techniques. Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 Insulin-Like Growth Factor-1 DES (1-3): Sequence TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK PAKSA more
    Brand Name:Info@desen-nutrition.com
    Model Number:IGF-1 DES
    Place of Origin:China

    CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1

  • Wholesale White Raw Powder Peptides Steroids Somatostatin Acetate 38916-34-6 for Insulin & Glucagon from china suppliers
    ...99% Peptide White Raw Powder Somatostatin Acetate 38916-34-6 for Insulin & Glucagon Basic Information: Product Name: Somatostatin Acetate Sequence: Cas No.: 38916-34-6 Molecular Formula: C76H104N18O19S2 ... more
    Brand Name:JCJ
    Model Number:Cas No.: 38916-34-6
    Place of Origin:China

    White Raw Powder Peptides Steroids Somatostatin Acetate 38916-34-6 for Insulin & Glucagon

    JCJ Logis Co.,ltd
    [Hubei,China]
  • Wholesale Human Growth Hormone Peptide Big Muscle 83 Amind Acid 100mcg IGTROPIN Long-R3 from china suppliers
    ... Muscle 83 Amind Acid 100mcg IGTROPIN Long-R3 Human Growth Hormone Peptide Detailed Description: Igtropin is a modified insulin-like factor, which is also referred to as Long R3 IGF-1. This tool is very... more
    Brand Name:Bodybiological
    Model Number:IGTROPIN
    Place of Origin:Hubei, China

    Human Growth Hormone Peptide Big Muscle 83 Amind Acid 100mcg IGTROPIN Long-R3

  • Wholesale Muscle Growth IGTROPIN Long-R3 IGF-1 Human Somatropin Injections from china suppliers
    ... IGF-1 Human Somatropin Injections Description IGTROPIN /IGF-1 lr3 plays a important role in muscle reinforcement. Igtropin (Long-R3 IGF-1) arouses both proliferation as well distinction of stem cells in an autocrine-paracrine... more
    Brand Name:IGTROPIN /IGF-1 lr3
    Model Number:100 mcg/vial * 10vials/kit
    Place of Origin:China

    Muscle Growth IGTROPIN Long-R3 IGF-1 Human Somatropin Injections

  • Wholesale 1000mg Injectable Human Growth Hormone Steroid Long R3 IGF 1 / IGTROPIN from china suppliers
    ..., below 2 ~ 8℃ preservation Origin China Product Name: IGTROPIN /IGF-1 lr3 Manufacturer: GenSci Laboratories, China. Substance: Insuline-like Growth Factor Package: 100 mcg/vial * 10vials/kit The most more
    Brand Name:Mking
    Model Number:IGTROPIN
    Place of Origin:Hubei, China

    1000mg Injectable Human Growth Hormone Steroid Long R3 IGF 1 / IGTROPIN

  • Wholesale Long Acting Insulin Glargine Injections from china suppliers
    ...Long acting insulin glargine Injections [Drug name]: Common name:Glargine Insulin Injection Trade name:Tang Aolin Chinese Pinyin:Ganjing Yidaosu Zhesheye [Ingredient]: Active ingredient:Insulin Glargine Chemical name: Chemical structure formula: Molecular ... more
    Categories:Pharmaceutical Medicines
    Country/Region:china

    Long Acting Insulin Glargine Injections

  • Wholesale Long Acting Insulin Glargine Injections from china suppliers
    ...Long acting insulin glargine Injections [Drug name]: Common name:Glargine Insulin Injection Trade name:Tang Aolin Chinese Pinyin:Ganjing Yidaosu Zhesheye [Ingredient]: Active ingredient:Insulin Glargine Chemical name: Chemical structure formula: Molecular ... more
    Categories:Active Pharmaceutical Ingredient
    Telephone:+86-571-82685132
    Country/Region:china

    Long Acting Insulin Glargine Injections

    pelym company
    [China]
  • Wholesale Polypeptide Hormones IGF1 LR3 Long Acting to Growth Muscle Burning Fat from china suppliers
    ...Polypeptide Hormones IGF1 LR3 Long Acting to Growth Muscle Burning Fat Reliable Contact Sales Manager Deca Lee Email decalee@steroid-hgh.... more
    Brand Name:Shanghai Stero
    Model Number:IGF1 LR3
    Place of Origin:China

    Polypeptide Hormones IGF1 LR3 Long Acting to Growth Muscle Burning Fat

    Shanghai Stero R&D Co,. Ltd
    [Shanghai,China]
  • Wholesale Traveling Diabetes Insulin Pen Long Acting For Patients Attractive Design from china suppliers
    ...Large Image Traveling Diabetes Insulin Pen Long Acting For Patients Attractive Design Product Details: Place of Origin: Shanghai, China Brand Name: Umitai Certification: ... more
    Categories:Diabetes Insulin Pen
    Country/Region:china

    Traveling Diabetes Insulin Pen Long Acting For Patients Attractive Design

Tell “long acting insulins” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0