• Wholesale  from china suppliers
    CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC Quick Detail of CJC 1295 Product name CJC-1295 without DAC Synonyms Mod GRF 1-29, CJC-1295 no DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 CAS Number 863288-34-0 Purity >98% by HPLC Molecular Formula C152H8252N44O42 Apperance white powder General Infomation Of CJC 1295 Description CJC-1295 DAC and CJC-1295 (also known as more
    Brand Name:Ycphar
    Model Number:863288-34-0
    Place of Origin:China

    CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC

  • Wholesale  from china suppliers
    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification 2mg/vail Assay 99.5% Appearance White powder Sermorelin Descriptions Sermorelin ( GHRH ) is a bio-identical hormone that has recently been genetically engineered to stimulate the secretion of Hormone Releasing Hormone ( GHRH ) from the hypothalamus, a more
    Brand Name:Fulu
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical

  • Wholesale  from china suppliers
    Polypeptide Growth Hormone Sermorelin Acetate/ Sermorelin with 2mg Bodybuilding 1. Sermorelin Information: Product Name:Sermorelin Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 Molecular weight: 3357.88 Peptide purity: > 98.0% Appearance: White lyophilized powder Related substance: Total Impurities (%) ≤ 2.0% Acetate content: ≤ 15.0% Bacterial Endotoxins: ≤5 IU/mg Sequence: H-Tyr-Ala- more
    Brand Name:Shuangbojie
    Model Number:Sermorelin Acetate
    Place of Origin:China

    Sermorelin Acetate Growth Hormone Muscle Building Peptides Pharmaceutical Active Ingredients 

  • Wholesale  from china suppliers
    Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular Formula C149H246N44O42S One Letter Sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2 Physical Apperance White Powder Form & Formulations Sterile Filtered white lyophilized (freeze-dried) Stability 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month more
    Model Number:99%
    Place of Origin:China
    Certification:ISO 9001

    Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2

  • Wholesale  from china suppliers
    ...Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification ... more
    Brand Name:Fulu
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical

    SuZhou FuLu Biotech Co.,Ltd
    [Jiangsu,China]
  • Wholesale  from china suppliers
    ...Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29 Quick Detail of Sermorelin Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-... more
    Brand Name:Ycphar
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29

  • Wholesale  from china suppliers
    ... Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding Description Sermorelin Acetate, also known as GRF 1-29 Amide, is a Growth Hormone Releasing Hormone (GHRH) produced by the brain that stimulates the production and release of Growth... more
    Brand Name:Biopro
    Model Number:PEP-116
    Place of Origin:China

    Lyophilized Peptide Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding

    Biopro Chemicals Co., Ltd.
    [Shanghai,China]
  • Wholesale  from china suppliers
    ...High Purity Growth Hormone Peptides Sermorelin For Mass Muscle Growth Sermorelin Basic Info Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-... more
    Brand Name:BestSteroid
    Model Number:2mg
    Place of Origin:Hubei,China

    Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7

  • Wholesale  from china suppliers
    ...Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Product information: Product name:GF-1Lr3 CAS ... more
    Brand Name:YIHAN
    Model Number:IGF-1 LR3
    Place of Origin:CHINA

    Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4

    Yihan Industrial Co.,Ltd.
    [Hongkong,China]
  • Wholesale  from china suppliers
    ...Human Growth Hormone Releasing Peptide GHRP-6 5mg 10mg For Lean Muscles Product name : GHRP-6 CAS NO.: 87616-84-0 ... more
    Brand Name:Pharmlab
    Model Number:87616-84-0
    Place of Origin:China

    Human Growth Hormone Releasing Peptide GHRP-6 5mg 10mg For Lean Muscles

    Pharmlab Co.,Ltd
    [Hubei,China]
  • Wholesale  from china suppliers
    ...Bodybuilding White powder Growth Hormone Peptides 1mg Follistatin 315 Antibody FST-315 Quick Detail: Product name Follistatin 315 Other name ... more
    Brand Name:Sendi
    Model Number:Pharmaceutical Grade
    Place of Origin:China

    Bodybuilding White powder Growth Hormone Peptides 1mg Follistatin 315 Antibody FST-315

  • Wholesale  from china suppliers
    ...Melanotan II Polypeptide Hormones CAS 121062-08-6 Melanotan 2 Human Growth Hormone MT-2 1. Quick Detail: Unit Size :10 mg/vial Unit Quantity :1 Vial CAS NO. :121062-08-6 ... more
    Brand Name:HKYC
    Model Number:121062-08-6
    Place of Origin:China

    Melanotan II Polypeptide Hormones CAS 121062-08-6 Melanotan 2 Human Growth Hormone MT-2

  • Wholesale  from china suppliers
    ... Increase Human Growth Hormone In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was... more
    Brand Name:KANGDISEN
    Model Number:2 mg/vial
    Place of Origin:China

    Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH

  • Wholesale  from china suppliers
    ...Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth == What kind of HGH do you have ? Here is our HGH in the from,pls ... more
    Brand Name:Gensci
    Model Number:10iu/vial,10vials/kit
    Place of Origin:China manufacturer

    Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth

  • Wholesale  from china suppliers
    ...Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-... more
    Model Number:99%
    Place of Origin:China
    Certification:ISO 9001

    Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2

  • Wholesale  from china suppliers
    ... Growth Hormone Peptides Hexarelin CAS 140703-51-1 Brief Inreocution of Growth Hormone Peptides Hexarelin Product name Hexarelin Other Name HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE... more
    Brand Name:NJBN STEROID
    Model Number:140703-51-1
    Place of Origin:MADE IN CHINA

    99% Pure White Powder Growth Hormone Peptides Hexarelin CAS 140703-51-1

  • Wholesale  from china suppliers
    ...Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7​ GHRP-2, like its brother GHRP-6, is a hexapeptide that is a pure growth hormone secretagogue. In addition, GHRP-2 is a synthetic... more
    Brand Name:YC
    Model Number:158861-67-7
    Place of Origin:China

    Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7

  • Wholesale  from china suppliers
    ...Hygetropin Human Growth Hormone Peptide HGH 191AA 100iu Hygetropin GH Product details: CAS No. : 96827-07-5 Purity : 97% Place ... more
    Brand Name:Bodybiological
    Model Number:96827-07-5
    Place of Origin:Hubei, China

    191AA Human Growth Hormone Peptide HGH 100iu GH 96827-07-5 Hygetropin

  • Wholesale  from china suppliers
    ...Bodybuilding Growth Hormone Peptide Follistatin 344 / Follistatin 315 / Ace 031 1mg / Vial Product Name Ace 031 Ace 031 ... more
    Brand Name:JNJG
    Model Number:Ace 031
    Place of Origin:CHINA

    Bodybuilding Growth Hormone Peptide Follistatin 344 / Follistatin 315 / Ace 031 1mg / Vial

  • Wholesale  from china suppliers
    ...The best peptide source Hexarelin Acetate 2mg Growth Hormone Steroid USA Stock for Muscle Gain Product Descriptions: CAS Number: 140703-51-1 Molecular Formula: C47H58N12O6 ... more
    Brand Name:NO
    Model Number:5 mg
    Place of Origin:China Mainland

    The best peptide source Hexarelin Acetate 2mg Growth Hormone Steroid USA Stock White lyophilized powder

    Walk Bio-Tech Co., Ltd.
    [Guangdong,China]
  • Wholesale  from china suppliers
    ...Triptorelin Peptide Growth Hormone For Anti Prostate Cancer CAS 57773-63-4 Synonym Triptorelin CAS NO 57773-63-4 Molecular Formula ... more
    Brand Name:Nanjian
    Place of Origin:China
    Certification:GMP, ISO 9001, USP

    Triptorelin Peptide Growth Hormone For Anti Prostate Cancer CAS 57773-63-4

  • Wholesale  from china suppliers
    ...99% GHRP-6 5mg Growth Hormone Releasing Hexapeptide 10mg 87616-84-0 Fat Loss 1, GHRP-6 Profile: Product Name: GHRP-6 Specification: 5mg & 10mg Synonyms: Growth Hormone Release Peptide-6; Growth Hormone Releasing Hexapeptide CAS: 87616-84-0 MF: C46H56N12O6 ... more
    Brand Name:Blue Dragon
    Model Number:GHRP-6 5mg & 10mg
    Place of Origin:China Manufacturer

    GHRP-6 5mg Growth Hormone Releasing Peptide Hexapeptide 10mg 87616-84-0

  • Wholesale  from china suppliers
    ...Hexarelin Powder Performance Enhancing Human Growth Hormone Peptide For Fat Loss CAS 140703-51-1 Quick Details: * Product name: Hexarelin/ Examorelin * Synonyms: L-lysinamide, L-... more
    Brand Name:Biofriend
    Model Number:140703-51-1
    Place of Origin:China

    Hexarelin Powder Performance Enhancing Human Growth Hormone For Weight Loss CAS 140703-51-1

  • Wholesale  from china suppliers
    ...Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7 Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 ... more
    Brand Name:HZ
    Model Number:86168-78-7
    Place of Origin:China

    Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7

Tell “sermorelin growth hormone” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0