• Wholesale CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC from china suppliers
    CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC Quick Detail of CJC 1295 Product name CJC-1295 without DAC Synonyms Mod GRF 1-29, CJC-1295 no DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 CAS Number 863288-34-0 Purity >98% by HPLC Molecular Formula C152H8252N44O42 Apperance white powder General Infomation Of CJC 1295 Description CJC-1295 DAC and CJC-1295 (also known as more
    Brand Name:Ycphar
    Model Number:863288-34-0
    Place of Origin:China

    CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC

  • Wholesale Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical from china suppliers
    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification 2mg/vail Assay 99.5% Appearance White powder Sermorelin Descriptions Sermorelin ( GHRH ) is a bio-identical hormone that has recently been genetically engineered to stimulate the secretion of Hormone Releasing Hormone ( GHRH ) from the hypothalamus, a more
    Brand Name:Fulu
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical

  • Wholesale Sermorelin Acetate Growth Hormone Muscle Building Peptides Pharmaceutical Active Ingredients  from china suppliers
    Polypeptide Growth Hormone Sermorelin Acetate/ Sermorelin with 2mg Bodybuilding 1. Sermorelin Information: Product Name:Sermorelin Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 Molecular weight: 3357.88 Peptide purity: > 98.0% Appearance: White lyophilized powder Related substance: Total Impurities (%) ≤ 2.0% Acetate content: ≤ 15.0% Bacterial Endotoxins: ≤5 IU/mg Sequence: H-Tyr-Ala- more
    Brand Name:Shuangbojie
    Model Number:Sermorelin Acetate
    Place of Origin:China

    Sermorelin Acetate Growth Hormone Muscle Building Peptides Pharmaceutical Active Ingredients

  • Wholesale Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2 from china suppliers
    Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular Formula C149H246N44O42S One Letter Sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2 Physical Apperance White Powder Form & Formulations Sterile Filtered white lyophilized (freeze-dried) Stability 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month more
    Model Number:99%
    Place of Origin:China
    Certification:ISO 9001

    Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2

  • Wholesale Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical from china suppliers
    ...Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification ... more
    Brand Name:Fulu
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical

    SuZhou FuLu Biotech Co.,Ltd
    [Jiangsu,China]
  • Wholesale Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29 from china suppliers
    ...Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29 Quick Detail of Sermorelin Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-... more
    Brand Name:Ycphar
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29

  • Wholesale Lyophilized Peptide Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding from china suppliers
    ... Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding Description Sermorelin Acetate, also known as GRF 1-29 Amide, is a Growth Hormone Releasing Hormone (GHRH) produced by the brain that stimulates the production and release of Growth... more
    Brand Name:Biopro
    Model Number:PEP-116
    Place of Origin:China

    Lyophilized Peptide Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding

    Biopro Chemicals Co., Ltd.
    [Shanghai,China]
  • Wholesale Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7 from china suppliers
    ...High Purity Growth Hormone Peptides Sermorelin For Mass Muscle Growth Sermorelin Basic Info Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-... more
    Brand Name:BestSteroid
    Model Number:2mg
    Place of Origin:Hubei,China

    Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7

  • Wholesale DSIP Delta Sleep Inducing Peptide DSIP 2mg/ vial Human Growth Hormone Peptides from china suppliers
    ...DSIP Delta Sleep Inducing Peptide DSIP 2mg Human Growth Hormone Peptides DSIP Specification 2mg/vial DSIP CAS No. 62568-57-4 DSIP Full name Delta Sleep ... more
    Brand Name:Zhenxiang
    Model Number:DSIP
    Place of Origin:CHINA

    DSIP Delta Sleep Inducing Peptide DSIP 2mg/ vial Human Growth Hormone Peptides

  • Wholesale Bodybuilding White powder Growth Hormone Peptides 1mg Follistatin 315 Antibody FST-315 from china suppliers
    ...Bodybuilding White powder Growth Hormone Peptides 1mg Follistatin 315 Antibody FST-315 Quick Detail: Product name Follistatin 315 Other name ... more
    Brand Name:Sendi
    Model Number:Pharmaceutical Grade
    Place of Origin:China

    Bodybuilding White powder Growth Hormone Peptides 1mg Follistatin 315 Antibody FST-315

  • Wholesale CAS 77591-33-4 Human Growth Hormone Peptides Steroid TB500 Powder For Muscle Gaining from china suppliers
    ...Human Growth Hormone Peptides Steroid TB500 Powder For Muscle Gaining CAS 77591-33-4 Besic Information Product name: TB500 ... more
    Brand Name:Pharmlab
    Model Number:77591-33-4
    Place of Origin:China

    CAS 77591-33-4 Human Growth Hormone Peptides Steroid TB500 Powder For Muscle Gaining

    Pharmlab Co.,Ltd
    [Hubei,China]
  • Wholesale CAS 75921-69-6 Growth Hormone Peptides Raw Powder MT1 / Melanotan 1 from china suppliers
    ...CAS 75921-69-6 Growth Hormone Peptides Raw Powder MT1 / Melanotan 1 Basic View: Alias: Melanotan-1, Melanotan I, Afamelanotide, Melanotan, CUV1647, EPT1647, NDP-... more
    Brand Name:kafen
    Model Number:75921-69-6
    Place of Origin:China

    CAS 75921-69-6 Growth Hormone Peptides Raw Powder MT1 / Melanotan 1

  • Wholesale High Purity Human Growth Hormone Powder Muscle Growth Peptides CAS 12629-01-5 from china suppliers
    ...Product Description Product name:Human (Growth) Peptide Hormone 1) Chemicalname:cb311;crecormon;humatrope;ly137998;norditropin;sj0011;OVINE SOMATOTROPIN;SOMATOTROPIN 2) CAS NO.:12629-01-5 3) Formula:... more
    Brand Name:shinrezing
    Model Number:12629-01-5
    Place of Origin:China

    High Purity Human Growth Hormone Powder Muscle Growth Peptides CAS 12629-01-5

  • Wholesale Muscle Building Peptides , GHRP-6 87616-84-0 Growth Hormone Peptides10mg / vial from china suppliers
    ...Muscle Building Peptides , GHRP-6 87616-84-0 Growth Hormone Peptides10mg / vial Product Name GHRP-6 Alias GHRP-6 (Growth hormone releasing peptide) CAS 87616-84-0 MF C46H56N12O6 Einecs N/A Molecular Weight 873.01 Purity (HPLC) 98.0%... more
    Brand Name:NJBN
    Model Number:87616-84-0
    Place of Origin:MADE IN CHINA

    Muscle Building Peptides , GHRP-6 87616-84-0 Growth Hormone Peptides10mg / vial

  • Wholesale Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 from china suppliers
    ...Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Product information: Product name:GF-1Lr3 CAS ... more
    Brand Name:YIHAN
    Model Number:IGF-1 LR3
    Place of Origin:CHINA

    Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4

    Yihan Industrial Co.,Ltd.
    [Hongkong,China]
  • Wholesale Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth from china suppliers
    ...Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth == What kind of HGH do you have ? Here is our HGH in the from,pls ... more
    Brand Name:Gensci
    Model Number:10iu/vial,10vials/kit
    Place of Origin:China manufacturer

    Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth

  • Wholesale Thymosin Beta 4 Peptides 2mg/Vial Tb500 Thymosin Beta-4/Tb4 For Human Growth Hormone from china suppliers
    ...Thymosin Beta 4 Peptides 2mg/Vial Tb500 Thymosin Beta-4/Tb4 For Human Growth Hormone Product Details: Synonyms: Thymosin Beta-4, Thymosin Beta-4 Acetate, Thymosin β4, TB-500 CAS NO.: 77591-33-4 ... more
    Brand Name:Muscle Man
    Model Number:77591-33-4
    Place of Origin:Hunan,China

    Thymosin Beta 4 Peptides 2mg/Vial Tb500 Thymosin Beta-4/Tb4 For Human Growth Hormone

  • Wholesale Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2 from china suppliers
    ...Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-... more
    Model Number:99%
    Place of Origin:China
    Certification:ISO 9001

    Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2

  • Wholesale Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7 from china suppliers
    ...Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7​ GHRP-2, like its brother GHRP-6, is a hexapeptide that is a pure growth hormone secretagogue. In addition, GHRP-2 is a synthetic... more
    Brand Name:YC
    Model Number:158861-67-7
    Place of Origin:China

    Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7

  • Wholesale 191AA Human Growth Hormone Peptide HGH 100iu GH 96827-07-5 Hygetropin from china suppliers
    ...Hygetropin Human Growth Hormone Peptide HGH 191AA 100iu Hygetropin GH Product details: CAS No. : 96827-07-5 Purity : 97% Place ... more
    Brand Name:Bodybiological
    Model Number:96827-07-5
    Place of Origin:Hubei, China

    191AA Human Growth Hormone Peptide HGH 100iu GH 96827-07-5 Hygetropin

  • Wholesale The best peptide source Hexarelin Acetate 2mg Growth Hormone Steroid USA Stock White lyophilized powder from china suppliers
    ...The best peptide source Hexarelin Acetate 2mg Growth Hormone Steroid USA Stock for Muscle Gain Product Descriptions: CAS Number: 140703-51-1 Molecular Formula: C47H58N12O6 ... more
    Brand Name:NO
    Model Number:5 mg
    Place of Origin:China Mainland

    The best peptide source Hexarelin Acetate 2mg Growth Hormone Steroid USA Stock White lyophilized powder

    Walk Bio-Tech Co., Ltd.
    [Guangdong,China]
  • Wholesale Sermorelin ( GHRH ) 5mg  Increase Human Growth Hormone Peptide Sermorelin acetate from china suppliers
    ... the secretion of Growth Hormone Releasing Hormone (GHRH) from the hypothalamus, a gland adjacent to the pituitary gland. Sermorelin ( GHRH ) 5mg Increase Human Growth Hormone Peptide Sermorelin acetate Sermorelin Quick View: Sermorelin is a peptide that... more
    Brand Name:ChineseHormone
    Model Number:CAS 86168-78-7
    Place of Origin:China

    Sermorelin ( GHRH ) 5mg Increase Human Growth Hormone Peptide Sermorelin acetate

  • Wholesale GHRP-6 5mg Growth Hormone Releasing Peptide Hexapeptide 10mg 87616-84-0 from china suppliers
    ...99% GHRP-6 5mg Growth Hormone Releasing Hexapeptide 10mg 87616-84-0 Fat Loss 1, GHRP-6 Profile: Product Name: GHRP-6 Specification: 5mg & 10mg Synonyms: Growth Hormone Release Peptide-6; Growth Hormone Releasing Hexapeptide CAS: 87616-84-0 MF: C46H56N12O6 ... more
    Brand Name:Blue Dragon
    Model Number:GHRP-6 5mg & 10mg
    Place of Origin:China Manufacturer

    GHRP-6 5mg Growth Hormone Releasing Peptide Hexapeptide 10mg 87616-84-0

  • Wholesale Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7 from china suppliers
    ...Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7 Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 ... more
    Brand Name:HZ
    Model Number:86168-78-7
    Place of Origin:China

    Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7

Tell “sermorelin growth hormone” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0