• Wholesale CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC from china suppliers
    CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC Quick Detail of CJC 1295 Product name CJC-1295 without DAC Synonyms Mod GRF 1-29, CJC-1295 no DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 CAS Number 863288-34-0 Purity >98% by HPLC Molecular Formula C152H8252N44O42 Apperance white powder General Infomation Of CJC 1295 Description CJC-1295 DAC and CJC-1295 (also known as more
    Brand Name:Ycphar
    Model Number:863288-34-0
    Place of Origin:China

    CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC

  • Wholesale Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical from china suppliers
    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification 2mg/vail Assay 99.5% Appearance White powder Sermorelin Descriptions Sermorelin ( GHRH ) is a bio-identical hormone that has recently been genetically engineered to stimulate the secretion of Hormone Releasing Hormone ( GHRH ) from the hypothalamus, a more
    Brand Name:Fulu
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical

  • Wholesale Sermorelin Acetate Growth Hormone Muscle Building Peptides Pharmaceutical Active Ingredients  from china suppliers
    Polypeptide Growth Hormone Sermorelin Acetate/ Sermorelin with 2mg Bodybuilding 1. Sermorelin Information: Product Name:Sermorelin Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 Molecular weight: 3357.88 Peptide purity: > 98.0% Appearance: White lyophilized powder Related substance: Total Impurities (%) ≤ 2.0% Acetate content: ≤ 15.0% Bacterial Endotoxins: ≤5 IU/mg Sequence: H-Tyr-Ala- more
    Brand Name:Shuangbojie
    Model Number:Sermorelin Acetate
    Place of Origin:China

    Sermorelin Acetate Growth Hormone Muscle Building Peptides Pharmaceutical Active Ingredients

  • Wholesale Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2 from china suppliers
    Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular Formula C149H246N44O42S One Letter Sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2 Physical Apperance White Powder Form & Formulations Sterile Filtered white lyophilized (freeze-dried) Stability 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month more
    Model Number:99%
    Place of Origin:China
    Certification:ISO 9001

    Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2

  • Wholesale Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical from china suppliers
    ...Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification ... more
    Brand Name:Fulu
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical

    SuZhou FuLu Biotech Co.,Ltd
    [Jiangsu,China]
  • Wholesale Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29 from china suppliers
    ...Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29 Quick Detail of Sermorelin Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-... more
    Brand Name:Ycphar
    Model Number:86168-78-7
    Place of Origin:China

    Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29

  • Wholesale Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7 from china suppliers
    ...High Purity Growth Hormone Peptides Sermorelin For Mass Muscle Growth Sermorelin Basic Info Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-... more
    Brand Name:BestSteroid
    Model Number:2mg
    Place of Origin:Hubei,China

    Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7

  • Wholesale Freeze - Dried Powder Gdf -8 / Myostatin Human Growth Hormone Peptides GDF - 8 from china suppliers
    ...Freeze - Dried Powder Gdf -8 / Myostatin Human Growth Hormone Peptides GDF - 8 MOQ: 10 vials Payment: Bank Transfer, Western Union, MoneyGram, Bitcoin Shipping Method: HKEMS, ... more
    Brand Name:Sendi
    Model Number:GDF-8
    Place of Origin:China

    Freeze - Dried Powder Gdf -8 / Myostatin Human Growth Hormone Peptides GDF - 8

  • Wholesale Anabolic Human Growth Hormone Peptide Tesamorelin 2mg/ Vial for Weight loss and Bodybuilding from china suppliers
    ...Bodybuilding Hormone Peptide Anabolic Steroids Weight Loss Tesamorelin 2mg/ Vial Quick detail Product name: Tesamorelin Other name: Sermorelin Acetate CAS: 218949-48-5 Appearance: white lyophilized powder purity: 99% Trademark: Pharmlab Original: China... more
    Brand Name:Pharmlab
    Model Number:218949-48-5
    Place of Origin:China

    Anabolic Human Growth Hormone Peptide Tesamorelin 2mg/ Vial for Weight loss and Bodybuilding

    Pharmlab Co.,Ltd
    [Hubei,China]
  • Wholesale Medicine Grade Oxytocin Growth Hormone Peptides / HGH Peptide Fragment CAS 50-56-6 from china suppliers
    ...Medicine Grade Oxytocin Growth Hormone Peptides / HGH Peptide Fragment CAS 50-56-6​ 1 . Specification Product Name: Oxtocin CAS: 50-56-6 ... more
    Brand Name:DW
    Model Number:CAS No:50-56-6
    Place of Origin:China

    Medicine Grade Oxytocin Growth Hormone Peptides / HGH Peptide Fragment CAS 50-56-6

  • Wholesale Growth Hormone Peptides Oxytocin 2mg / vial For Hasten Parturition CAS 50-56-6 from china suppliers
    ...Growth Hormone Peptides Oxytocin 2mg / vial For Hasten Parturition CAS 50-56-6 1. Oxytocin Details: Name: oxytocin synonyms: +... more
    Brand Name:Yvonne
    Model Number:50-56-6
    Place of Origin:China

    Growth Hormone Peptides Oxytocin 2mg / vial For Hasten Parturition CAS 50-56-6

  • Wholesale USP Standard Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4 from china suppliers
    ...Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4 USP Standard Oxandrolone / Anavar Quick Info Product Name: Oxandrolone CAS: ... more
    Brand Name:Mking
    Model Number:CAS 53-39-4
    Place of Origin:Hubei, China

    USP Standard Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4

  • Wholesale Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 from china suppliers
    ...Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Product information: Product name:GF-1Lr3 CAS ... more
    Brand Name:YIHAN
    Model Number:IGF-1 LR3
    Place of Origin:CHINA

    Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4

    Yihan Industrial Co.,Ltd.
    [Hongkong,China]
  • Wholesale Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth from china suppliers
    ...Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth == What kind of HGH do you have ? Here is our HGH in the from,pls ... more
    Brand Name:Gensci
    Model Number:10iu/vial,10vials/kit
    Place of Origin:China manufacturer

    Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth

  • Wholesale Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2 from china suppliers
    ...Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-... more
    Model Number:99%
    Place of Origin:China
    Certification:ISO 9001

    Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2

  • Wholesale 99% Pure White Powder Growth Hormone Peptides Hexarelin CAS 140703-51-1 from china suppliers
    ... Growth Hormone Peptides Hexarelin CAS 140703-51-1 Brief Inreocution of Growth Hormone Peptides Hexarelin Product name Hexarelin Other Name HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE... more
    Brand Name:NJBN STEROID
    Model Number:140703-51-1
    Place of Origin:MADE IN CHINA

    99% Pure White Powder Growth Hormone Peptides Hexarelin CAS 140703-51-1

  • Wholesale PT-141 Human Growth Hormone Lyophilized Inject 2mg/Vial For Male Sexual Enhancement from china suppliers
    ...PT-141 Human Growth Hormone Lyophilized inject 2mg/vial for male sexual enhancement Quick details: PT-141(Bremelanotide) is the ... more
    Brand Name:peptide
    Model Number:10mg/ vial
    Place of Origin:China manufactuer

    PT-141 Human Growth Hormone Lyophilized Inject 2mg/Vial For Male Sexual Enhancement

  • Wholesale Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7 from china suppliers
    ...Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7​ GHRP-2, like its brother GHRP-6, is a hexapeptide that is a pure growth hormone secretagogue. In addition, GHRP-2 is a synthetic... more
    Brand Name:YC
    Model Number:158861-67-7
    Place of Origin:China

    Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7

  • Wholesale 191AA Human Growth Hormone Peptide HGH 100iu GH 96827-07-5 Hygetropin from china suppliers
    ...Hygetropin Human Growth Hormone Peptide HGH 191AA 100iu Hygetropin GH Product details: CAS No. : 96827-07-5 Purity : 97% Place ... more
    Brand Name:Bodybiological
    Model Number:96827-07-5
    Place of Origin:Hubei, China

    191AA Human Growth Hormone Peptide HGH 100iu GH 96827-07-5 Hygetropin

  • Wholesale 99% Purity Fitness Growth Hormone Peptides Muscle Building Steroids Gh Fragment 176-191 from china suppliers
    ...Fitness Growth Hormone Peptides Gh Fragment 176-191 H-GH Fragments 176-191 Details H-GH Fragments 176-191 Name: ... more
    Brand Name:Yuancheng
    Model Number:57773-63-4
    Place of Origin:China

    99% Purity Fitness Growth Hormone Peptides Muscle Building Steroids Gh Fragment 176-191

  • Wholesale GHRP-6 5mg Growth Hormone Releasing Peptide Hexapeptide 10mg 87616-84-0 from china suppliers
    ...99% GHRP-6 5mg Growth Hormone Releasing Hexapeptide 10mg 87616-84-0 Fat Loss 1, GHRP-6 Profile: Product Name: GHRP-6 Specification: 5mg & 10mg Synonyms: Growth Hormone Release Peptide-6; Growth Hormone Releasing Hexapeptide CAS: 87616-84-0 MF: C46H56N12O6 ... more
    Brand Name:Blue Dragon
    Model Number:GHRP-6 5mg & 10mg
    Place of Origin:China Manufacturer

    GHRP-6 5mg Growth Hormone Releasing Peptide Hexapeptide 10mg 87616-84-0

  • Wholesale Hexarelin Powder Performance Enhancing Human Growth Hormone For Weight Loss CAS 140703-51-1 from china suppliers
    ...Hexarelin Powder Performance Enhancing Human Growth Hormone Peptide For Fat Loss CAS 140703-51-1 Quick Details: * Product name: Hexarelin/ Examorelin * Synonyms: L-lysinamide, L-... more
    Brand Name:Biofriend
    Model Number:140703-51-1
    Place of Origin:China

    Hexarelin Powder Performance Enhancing Human Growth Hormone For Weight Loss CAS 140703-51-1

  • Wholesale Lyophilized Peptide Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding from china suppliers
    ... Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding Description Sermorelin Acetate, also known as GRF 1-29 Amide, is a Growth Hormone Releasing Hormone (GHRH) produced by the brain that stimulates the production and release of Growth... more
    Brand Name:Biopro
    Model Number:PEP-116
    Place of Origin:China

    Lyophilized Peptide Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding

    Biopro Chemicals Co., Ltd.
    [Shanghai,China]
  • Wholesale Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7 from china suppliers
    ...Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7 Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 ... more
    Brand Name:HZ
    Model Number:86168-78-7
    Place of Origin:China

    Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7

Tell “sermorelin growth hormone” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0